DDB1/CRBN Complex, Flag&His Tag, Human
SKU: 65522343487

DDB1/CRBN Complex, Flag&His Tag, Human

$162.00 $180.00
Save 10%
No.2 Bestseller on www.unreveavivre.org >

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

DDB1/CRBN Complex, Flag&His Tag, HumanProduct Specification Species Human Synonyms DDB1 CRBN Complex Accession Q16531Q96SW2 Amino Acid Sequence DDB1 Flag Tag, Human Met1 His1140

Product Specification


Species Human
Synonyms DDB1/CRBN Complex
Accession Q16531、Q96SW2
Amino Acid Sequence

DDB1 Flag Tag, Human
Met1-His1140
DYKDDDDKMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
CRBN His Tag, Human
Met1-Leu442
HHHHHHHHGGGSGGGSMAGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQEREAQFGTTAEIYAYREEQDFGIEIVKVKAIGRQRFKVLELRTQSDGIQQA
KVQILPECVLPSTMSAVQLESLNKCQIFPSKPVSREDQCSYKWWQKYQKRKFHCANLTSWPRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPSNPIDFSYRVAACLPIDDVLRIQLLKIGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTIPDTEDEISPDKVILCL
Expression System Baculovirus-InsectCells
Molecular Weight

128&53kDa (Reducing)
Purity ＞95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tags & Cleavage sites Flag Tag; His Tag
Physical Appearance Liquid
Storage Buffer 20mM Tris,300mM NaCl,10%Glycerol,1mM DTT, pH7.5.
Stability & Storage

·12 months from date of receipt, -20 to -70 °C as supplied.
·1 month, 2 to 8 °C under sterile conditions after reconstitution.
·Please avoid repeated freeze-thaw cycles.
Reference

Fischer E.S.,et al. (2014) Nature 512: 49
He Y.J., et al. (2006) Genes Dev. 20: 2949
Ito T., et al. (2010) Science 327: 1345
Wang H., et al. (2006) Mol. Cell 22: 383

Background

Cereblon (CRBN) is the substrate recognition component of DCX (DDB1-CUL4-X-box) E3 Ubiquitin ligase complexes that mediate the ubiquitination of numerous target proteins including the transcriptional regulator MEIS2. CRBN plays an important role in limb outgrowth, and its function in this process is perturbed by the binding of thalidomide and related compounds. Binding of CRBN to Cullin-4 is mediated in part by DNA damage-binding protein 1 (DDB1), a component of multiple DCX class ligases. In addition to its role in limb development, DDB1 is also involved in various DNA damage response mechanisms. This product consists of an untagged complex of DDB1 and CRBN.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65522343487

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 813 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Bonnie
Draper, US
★★★★★ 5
Is this the CURE!
Size: Regular, Color: Cream
I have a skin disease called Ichthyosis Vulgaris. Yes, SCALEY FISH! Thanks MOM! This unfortunate crud leaves my heels an embarrassing mess! They are cracked and dry and literally like concrete. I have had this disease all my life and there is NO cure. It's hideous! Anyway, I have tried so many different experiments to help improve my situation. So much time and money I will never get back. So when I saw these, I had to give them a try too because I am a forever optimist and love being disappointed. Here's how it went. First I put my dermatologist recommended AmLactin on my crusty heels. Then, I put the socks on. By the way, with no problem at all, and went to bed. I was not too hot, which is usually what happens when I sleep with socks on. I never even realized that I had them on. When I woke up, I took them off and immediately used a "Heel File" over a towel removing all the yuck!. Then, I sand papered them to smooth the skin out. Then, I doused them with Shea and Aloe foot lotion I found at the bottom of my experiment drawer in my bathroom. Oh, they felt like someone else's feet. I am very hopeful at this moment! Is this the cure to my embarrassing situation? I sure hope so. Spring is here and I would really like to wear my cute flip-flops when I go to the Waffle House and set at the bar. Wasn't that a picture on Facebook of someone nasty heels? It made me gag. Then, I had to make sure that picture wasn't me! I am going to do this for a week and come back for another review. Wish me luck ya'll! UPDATE! So it’s been about two weeks. I wish that I had taken a before and after picture. I guess I figure that this too will be a waste of money. NO! These little socks are a God send for me. I did buy AmLactin foot repair cream and that I highly recommend. It’s the best so far. They also offer an option with heel socks. They are soft and work very well also but one negative. They leave fuzzies on you feet and tools. Guys this is it for me. My search is over! I went to my mani/pedi queen yesterday and she was shocked when she saw my feet. She is spreading the word!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 23, 2025
C
Verified Purchase
Crowder
Fort Morgan, US
★★★★★ 5
Great reusable moisturizing
Size: Regular, Color: Cream
Love these! Use them often to help moisturize my heels with my favorite moisturizer. Comfortable and easy to use
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
H
Verified Purchase
Heather
New York, US
★★★★★ 5
Buy these!
Size: Regular, Color: Cream
I only write a review when I have a strong opinion and want to help others decide. I've been having trouble with cracked heels for months. Previously I had just been using regular socks, but these slip-ons have been game changers! They don't make my feet hot at night. They are comfortable and in the morning my heels feel soft, and I don't need to use them everyday. They look good and fit well even if I want to wear them under socks or in shoes during the day. They really do help if you have cracked heels along with some kind of lotion. Definitely effective!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2025
B
Verified Purchase
Beverly K.
Birmingham, US
★★★★★ 5
Cracked heels are gone after 5 applications
Size: Regular, Color: Cream
These moisturizing socks work great. My heels are happy again. The open toe design makes it so my feet don’t overheat at night. It only took 5 times to get rid of my painful cracked heels. Now I wear them 1-2 times a week to keep my heels healthy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 6, 2026
L
Verified Purchase
Lori
Cuba, US
★★★★★ 4
Really nice but needs a few small improvements
Size: Regular, Color: Cream
Super comfortable and the gel lining feels so nice on my feet. They seem to do their job and help with moisturizing and so far the quality has been great. I deducted a star because they can be difficult to clean and may not fit wider feet. Otherwise a great value for your money
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 31, 2025

recommand products

Transferrin His Tag Protein, Mouse
120.00
Human VAChT ELISA Kit
184.12
Human UbcH5c ELISA Kit
184.12
Human TSG101 ELISA Kit
184.12
Human LGMN ELISA Kit
184.12