DDB1/CRBN Complex, Flag&His Tag, Human
SKU: 45357149263

DDB1/CRBN Complex, Flag&His Tag, Human

Sale price$162.00 Regular price$180.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 7 - Jul 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

DDB1/CRBN Complex, Flag&His Tag, HumanProduct Specification Species Human Synonyms DDB1 CRBN Complex Accession Q16531Q96SW2 Amino Acid Sequence DDB1 Flag Tag, Human Met1 His1140

Product Specification


Species Human
Synonyms DDB1/CRBN Complex
Accession Q16531、Q96SW2
Amino Acid Sequence

DDB1 Flag Tag, Human
Met1-His1140
DYKDDDDKMSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEVEETELMGFVDDQQTFFCGNVAHQQLIQITSASVRLVSQEPKALVSEWKEPQAKNISVASCNSSQVVVAVGRALYYLQIHPQELRQISHTEMEHEVACLDITPLGDSNGLSPLCAIGLWTDISARILKLPSFELLHKEMLGGEIIPRSILMTTFESSHYLLCALGDGALFYFGLNIETGLLSDRKKVTLGTQPTVLRTFRSLSTTNVFACSDRPTVIYSSNHKLVFSNVNLKEVNYMCPLNSDGYPDSLALANNSTLTIGTIDEIQKLHIRTVPLYESPRKICYQEVSQCFGVLSSRIEVQDTSGGTTALRPSASTQALSSSVSSSKLFSSSTAPHETSFGEEVEVHNLLIIDQHTFEVLHAHQFLQNEYALSLVSCKLGKDPNTYFIVGTAMVYPEEAEPKQGRIVVFQYSDGKLQTVAEKEVKGAVYSMVEFNGKLLASINSTVRLYEWTTEKELR
TECNHYNNIMALYLKTKGDFILVGDLMRSVLLLAYKPMEGNFEEIARDFNPNWMSAVEILDDDNFLGAENAFNLFVCQKDSAATTDEERQHLQEVGLFHLGEFVNVFCHGSLVMQNLGETSTPTQGSVLFGTVNGMIGLVTSLSESWYNLLLDMQNRLNKVIKSVGKIEHSFWRSFHTERKTEPATGFIDGDLIESFLDISRPKMQEVVANLQYDDGSGMKREATADDLIKVVEELTRIH
CRBN His Tag, Human
Met1-Leu442
HHHHHHHHGGGSGGGSMAGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQEREAQFGTTAEIYAYREEQDFGIEIVKVKAIGRQRFKVLELRTQSDGIQQA
KVQILPECVLPSTMSAVQLESLNKCQIFPSKPVSREDQCSYKWWQKYQKRKFHCANLTSWPRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPSNPIDFSYRVAACLPIDDVLRIQLLKIGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLPTIPDTEDEISPDKVILCL

Expression System Baculovirus-InsectCells
Molecular Weight

128&53kDa (Reducing)

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tags & Cleavage sites Flag Tag; His Tag
Physical Appearance Liquid
Storage Buffer 20mM Tris,300mM NaCl,10%Glycerol,1mM DTT, pH7.5.
Stability & Storage

·12 months from date of receipt, -20 to -70 °C as supplied.
·1 month, 2 to 8 °C under sterile conditions after reconstitution.
·Please avoid repeated freeze-thaw cycles.

Reference

Fischer E.S.,et al. (2014) Nature 512: 49
He Y.J., et al. (2006) Genes Dev. 20: 2949
Ito T., et al. (2010) Science 327: 1345
Wang H., et al. (2006) Mol. Cell 22: 383

Background

Cereblon (CRBN) is the substrate recognition component of DCX (DDB1-CUL4-X-box) E3 Ubiquitin ligase complexes that mediate the ubiquitination of numerous target proteins including the transcriptional regulator MEIS2. CRBN plays an important role in limb outgrowth, and its function in this process is perturbed by the binding of thalidomide and related compounds. Binding of CRBN to Cullin-4 is mediated in part by DNA damage-binding protein 1 (DDB1), a component of multiple DCX class ligases. In addition to its role in limb development, DDB1 is also involved in various DNA damage response mechanisms. This product consists of an untagged complex of DDB1 and CRBN.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 45357149263

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 74 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Cam
Bozeman, US
★★★★★ 5
My dog loves this
Color: Blue Yellow, Pattern Name: Alligator
My dogs favorite toy and she has a lot of toys. Sturdy for tugging
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
L
Verified Purchase
Lk
Natrona Heights, US
★★★★★ 5
Dogs both love it
Color: Blue, Pattern Name: Toucan
Dogs are obsessed with this, somehow has not been gutted yet. Long enough that they can both play with it. Neck not as stretchy as I envisioned but it’s fine.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
D
Verified Purchase
Deborah Gottert
New York, US
★★★★★ 1
Not worth the money
Color: Green, Pattern Name: Dinosaur
Thought it would be larger as it states LARGE-it was not- it is not interactive - also states that but it is not - so value for the money is not correct - not worth it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026
K
Verified Purchase
KG216
Alexandria, US
★★★★★ 3
Cute, but short-lived
Color: Blue, Pattern Name: Toucan
Santa brought this for our 3-year-old sheepadoodle! Super cute, but she tore it up within a few days. We did like the stretchy neck! She had a lot of fun with it while it lasted.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
W
Verified Purchase
wild animals
Natrona Heights, US
★★★★★ 5
Best toy, the end
Style: Sport, Size: 12in, Style: Sport, Size: 12in
Combined with the Max Glow ball, this is the best dog toy available on modern planet Earth. I have a burly 92lb. pit bull mix with highly developed prey drive, and she will chase the glow ball for hours if I let her. The tiny sport launcher (Sport 12M) is the best, because you can still throw the ball really far, but you can also slam the ball down a few feet away from yourself so it bounces up in the air and your dog has to jump to catch it, or you can throw it up really high so it bounces 15' away or so and your dog can jump to catch it. We sometimes have to play fetch in a pretty small area, so it's nice to have the small launcher for these games. The larger launchers aren't as fun in small areas. You can play the same games but it's trickier to throw the ball correctly. Also, the small launcher is a lot easier to carry. The small launcher fits in my dog-walk-stuff backpack (with the ball in the launcher so I don't have to dig for it later), but the big ones don't easily. The launcher also has a hole in the end so you can hang it from your bag or whatever with a carabiner. The big ones are too long for that in most cases, and swing back and forth. Also-also my dog loves to ask for the launcher, then when I give it to her she plays keep-away and it's adorable. The big launcher I have is harder for her to balance in her mouth, so she just lays down and chews on it until it gets taken away. She's chewed on all of the four Chuck Its we've owned, but she's only broken one (a big one), but that's because she got ahold of it when no one was home. The little one in my bag is totally chewed up but still works great. I think they're sturdier than the big ones. Except for the launcher she chewed into pieces, which was our fault, the only reason we've had to replace anything was because we lost it. Usually we keep the launcher and ball in the backpack so she can't get to them and so they don't get lost, so we rarely have to replace them. There is just not a better value in toys, and the startup price is really low. Once again I really recommend the glow ball! It doesn't get soggy no matter how wet the grass or the dog mouth is. It is fun to chase because it is slippery and it collapses when it's squeezed, so it pops out of the dog's mouth and flies away if they bite it at the wrong angle; it's really bouncy, and stays bouncy because it can't be popped; it whistles so you can usually hear it even if you can't see it; and it really glows enough for nighttime catch, even if you only have your cellphone flashlight to charge it up! UPDATE: I should have said, we have the 12M launcher, which means the handle is 12 inches long and it uses a medium-sized ball. The medium ball is 2.5 inches in diameter, so the launcher will fit regular tennis balls, too! But my dog won't play with regular tennis balls anymore because they aren't anywhere near as fun as the glow balls, and I think she doesn't like having gross sloshy muddy tennis balls in her mouth. I lost my short launcher awhile back and could only get a long one locally to replace it, which reminded me that you have to lean over a lot further to use the short launcher. So if you have trouble leaning over to the point that your hand is a foot above the ground, this may be hard for you to use. I wish Amazon would let us choose colors, because my old one was green, and the big one is orange, both of which are bright enough to see in the grass from far away, even at night. Still, best toy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2017

recommand products